- KCNK17 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92041
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- K2p17.1, TALK-2, TALK2, TASK-4, TASK4
- 0.1 ml
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: CSCCHHSSKE DFKSQSWRQG PDREPESHSP QQGCYPEGPM GIIQHLEPSA HAAGCGKDS
- KCNK17
- Human
- potassium two pore domain channel subfamily K member 17
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Specifications/Features
Available conjugates: Unconjugated